Recombinant Mouse Protein EVI2A(Evi2a)

SKU: CSB-CF007865MO

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P20934

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SSSSGTRPNYTHLWASSVTASGSSNQNGSSRHPSDNNTNLVTPAVGHKVSATDKPASSPPVPLASTSTLKSSTPHAFRNSSPTAEIKSQGETFKKEVCEENTSNTAMLICLIVIAVLFLICTFLFLSTVVLANKVSSLKRSKQVGKRQPRSNGDFLASSGLWTAESDTWKRAKELTGSNLLLQSPGVLTAARERKHEEGTEKLN

Protein Names:Recommended name: Protein EVI2A Alternative name(s): Ecotropic viral integration site 2A protein Short name= EVI-2A

Gene Names:Name:Evi2a Synonyms:Evi-2, Evi-2a, Evi2

Expression Region:20-223

Sequence Info:full length protein