Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Signal Transduction
Uniprot ID: P86546
Gene Names: Bglap
Organism: Mus musculus (Mouse)
AA Sequence: YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI
Expression Region: 50-95aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 21.1 kDa
Alternative Name(s): Bone Gla protein Short name: BGP Gamma-carboxyglutamic acid-containing protein
Relevance: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.
Reference: "The mouse osteocalcin gene cluster contains three genes with two separate spatial and temporal patterns of expression."Desbois C., Hogue D.A., Karsenty G.J. Biol. Chem. 269:1183-1190(1994)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.