Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Opalin(Opalin)

Recombinant Mouse Opalin(Opalin)

SKU:CSB-CF745364MO

Regular price $2,080.40 CAD
Regular price Sale price $2,080.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q7M750

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFSLNFTLPSNTTSSPVVTSAKATDCGPSIGLAAGIPSLLATALLVALLFTLIQRRRTI DDEPVEETEIPCEISELYDNPKISENPRRSPTHEMNPRGSQEGHIYVKTVSGSEEPLPDT YRPPEELERRRGLWWLVPSLSLE

Protein Names:Recommended name: Opalin Alternative name(s): Oligodendrocytic myelin paranodal and inner loop protein Transmembrane protein 10

Gene Names:Name:Opalin Synonyms:Tmem10

Expression Region:1-143

Sequence Info:full length protein

View full details