Gene Bio Systems
Recombinant Mouse Opalin(Opalin)
Recombinant Mouse Opalin(Opalin)
SKU:CSB-CF745364MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:Q7M750
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSFSLNFTLPSNTTSSPVVTSAKATDCGPSIGLAAGIPSLLATALLVALLFTLIQRRRTI DDEPVEETEIPCEISELYDNPKISENPRRSPTHEMNPRGSQEGHIYVKTVSGSEEPLPDT YRPPEELERRRGLWWLVPSLSLE
Protein Names:Recommended name: Opalin Alternative name(s): Oligodendrocytic myelin paranodal and inner loop protein Transmembrane protein 10
Gene Names:Name:Opalin Synonyms:Tmem10
Expression Region:1-143
Sequence Info:full length protein
