Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse NKG2-D type II integral membrane protein(Klrk1)

Recombinant Mouse NKG2-D type II integral membrane protein(Klrk1)

SKU:CSB-CF012474MO

Regular price $2,212.00 CAD
Regular price Sale price $2,212.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:O54709

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MALIRDRKSHHSEMSKCHNYDLKPAKWDTSQEQQKQRLALTTSQPGENGIIRGRYPIEKLKISPMFVVRVLAIALAIRFTLNTLMWLAIFKETFQPVLCNKEVPVSSREGYCGPCPNNWICHRNNCYQFFNEEKTWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQIPANGSWQWEDGSSLSYNQLTLVEIPKGSCAVYGSSFKAYTEDCANLNTYICMKRAV

Protein Names:Recommended name: NKG2-D type II integral membrane protein Alternative name(s): Killer cell lectin-like receptor subfamily K member 1 NK cell receptor D NKG2-D-activating NK receptor CD_antigen= CD314

Gene Names:Name:Klrk1 Synonyms:Nkg2d

Expression Region:1-232

Sequence Info:full length protein

View full details