Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Neuropeptide Y receptor type 2(Npy2r),partial

Recombinant Mouse Neuropeptide Y receptor type 2(Npy2r),partial

SKU:CSB-EP016036MO1

Regular price $1,466.79 CAD
Regular price Sale price $1,466.79 CAD
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Cardiovascular

Uniprot ID:P97295

Gene Names:Npy2r

Organism:Mus musculus (Mouse)

AA Sequence:MGPVGAEADENQTVEVKVEPYGPGHTTPRGELPPDPEPELIDSTKLVEVQV

Expression Region:1-51aa

Sequence Info:Extracellular Domain

Source:E.coli

Tag Info:N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

MW:25.5 kDa

Alternative Name(s):NPY-Y2 receptor (Y2 receptor)

Relevance:Receptor for neuropeptide Y and peptide YY.

Reference:"Normal feeding behavior, body weight and leptin response require the neuropeptide Y Y2 receptor." Naveilhan P., Hassani H., Canals J.M., Ekstrand A.J., Larefalk A., Chhajlani V., Arenas E., Gedda K., Svensson L., Thoren P., Ernfors P. Nat. Med. 5:1188-1193(1999)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Receptor for neuropeptide Y and peptide YY.

Involvement in disease:

Subcellular Location:Cell membrane, Multi-pass membrane protein

Protein Families:G-protein coupled receptor 1 family

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Mm&CID=1433

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?mmu:18167

STRING Database Link:https://string-db.org/network/10090.ENSMUSP00000096595

OMIM Database Link:

Lead Time Guidance:13-23 business days

View full details