Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6(Ndufb6)

Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6(Ndufb6)

SKU:CSB-CF662371MO

Regular price $1,836.25 CAD
Regular price Sale price $1,836.25 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q3UIU2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPRRMWPLERFWDNFLRDGAVWKNMV FKAYRSSLFAVSHVLIPMWFVHYYVKYHMATKPYTIVSSKPRIFPGDTILETGEVIPPMR DFPDQHH

Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 Alternative name(s): Complex I-B17 Short name= CI-B17 NADH-ubiquinone oxidoreductase B17 subunit

Gene Names:Name:Ndufb6 Synonyms:Gm137

Expression Region:2-128

Sequence Info:full length protein

View full details