Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse MLN64 N-terminal domain homolog(Stard3nl)

Recombinant Mouse MLN64 N-terminal domain homolog(Stard3nl)

SKU:CSB-CF887595MO

Regular price $2,216.20 CAD
Regular price Sale price $2,216.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q9DCI3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNHLPEHMENTLTGSQSSHASLRDIHSINPAQLMARIESYEGREKKGISDVRRTFCLFVT FDLLFVTLLWIIELNVNGGIENTLKKEVIHYDYYSSYFDIFLLAVFRFKVLILGYAVCRL RHWWAIALTTAVTSAFLLAKVILSKLFSQGAFGYVLPIISFILAWIETWFLDFKVLPQEA EEENRLLLVQDASERAALIPAGLSDGQFYSPPESEAGSEEEAEEKQESEKPLLEL

Protein Names:Recommended name: MLN64 N-terminal domain homolog Alternative name(s): STARD3 N-terminal-like protein

Gene Names:Name:Stard3nl Synonyms:Mentho

Expression Region:1-235

Sequence Info:full length protein

View full details