Recombinant Mouse Major urinary protein 6(Mup6)

Recombinant Mouse Major urinary protein 6(Mup6)

CSB-EP360881MO
Regular price
$907.00 CAD
Sale price
$907.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P02762

Gene Names: Mup6

Organism: Mus musculus (Mouse)

AA Sequence: MKMLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

Expression Region: 1-180aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 36.6 kDa

Alternative Name(s): Alpha-2U-globulin Group 1, BS6 Allergen: Mus m 1

Relevance: Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females.

Reference: "Sequence structures of a mouse major urinary protein gene and pseudogene compared."Clark A.J., Ghazal P., Bingham R.W., Barrett D., Bishop J.O.EMBO J. 4:3159-3165(1985)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share