Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P02762
Gene Names: Mup6
Organism: Mus musculus (Mouse)
AA Sequence: MKMLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE
Expression Region: 1-180aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 36.6 kDa
Alternative Name(s): Alpha-2U-globulin Group 1, BS6 Allergen: Mus m 1
Relevance: Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females.
Reference: "Sequence structures of a mouse major urinary protein gene and pseudogene compared."Clark A.J., Ghazal P., Bingham R.W., Barrett D., Bishop J.O.EMBO J. 4:3159-3165(1985)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.