
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171228
Research areas: Others
Target / Protein: Ly6e
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Mus musculus (Mouse)
Delivery time: 3-7 business days
Uniprot ID: Q64253
AA Sequence: LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 21-102aa
Protein length: Full Length of Mature Protein
MW: 24.8 kDa
Alternative Name(s): Stem cell antigen 2 Thymic shared antigen 1 Short name: TSA-1
Relevance: Involved in T-cell development.
Reference: "Mouse stem cell antigen Sca-2 is a member of the Ly-6 family of cell surface proteins."Classon B.J., Coverdale L.Proc. Natl. Acad. Sci. U.S.A. 91:5296-5300(1994)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.