Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P0CW02
Gene Names: Ly6c1
Organism: Mus musculus (Mouse)
AA Sequence: LQCYECYGVPIETSCPAVTCRASDGFCIAQNIELIEDSQRRKLKTRQCLSFCPAGVPIRDPNIRERTSCCSEDLCNAAVPTAG
Expression Region: 27-109aa
Sequence Info: Full Length of Mature Protein
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 11.1 kDa
Alternative Name(s):
Relevance:
Reference: "B cells express Ly-6C in a Th1 but not Th2 cytokine environment." Schlueter A.J., Krieg A.M., De Vries P., Li X. J. Interferon Cytokine Res. 22:799-806(2002)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.