Recombinant Mouse Low affinity immunoglobulin epsilon Fc receptor(Fcer2)

SKU: CSB-CF008534MO

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P20693

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEENEYSGYWEPPRKRCCCARRGTQLMLVGLLSTAMWAGLLALLLLWHWETEKNLKQLGDTAIQNVSHVTKDLQKFQSNQLAQKSQVVQMSQNLQELQAEQKQMKAQDSRLSQNLTGLQEDLRNAQSQNSKLSQNLNRLQDDLVNIKSLGLNEKRTASDSLEKLQEEVAKLWIEILISKGTACNICPKNWLHFQQKCYYFGKGSKQWIQARFACSDLQGRLVSIHSQKEQDFLMQHINKKDSWIGLQDLNMEGEFVWSDGSPVGYSNWNPGEPNNGGQGEDCVMMRGSGQWNDAFCRSYLDAWVCEQLATCEISAPLASVTPTRPTPKSEP

Protein Names:Recommended name: Low affinity immunoglobulin epsilon Fc receptor Alternative name(s): Fc-epsilon-RII Lymphocyte IgE receptor CD_antigen= CD23

Gene Names:Name:Fcer2 Synonyms:Fcer2a

Expression Region:1-331

Sequence Info:full length protein