Gene Bio Systems
Recombinant Mouse Leukocyte-specific transcript 1 protein(Lst1)
Recombinant Mouse Leukocyte-specific transcript 1 protein(Lst1)
SKU:CSB-CF013217MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:O08843
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSDDNGSGNNCTTNHFLLYGSLGLGGLLLLLVIILFICLCGFSQRVKRLERNAQVSGQEP HYASLQQLPVSSSDITDMKEDLSTDYACIARSTPT
Protein Names:Recommended name: Leukocyte-specific transcript 1 protein Alternative name(s): Protein B144
Gene Names:Name:Lst1 Synonyms:B144
Expression Region:1-95
Sequence Info:Full length protein
