Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Junctional adhesion molecule A(F11r)

Recombinant Mouse Junctional adhesion molecule A(F11r)

SKU:CSB-CF007917MO

Regular price $2,273.60 CAD
Regular price Sale price $2,273.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:O88792

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:KGSVYTAQSDVQVPENESIKLTCTYSGFSSPRVEWKFVQGSTTALVCYNSQITAPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEEGGQNYGEVSIHLTVLVPPSKPTISVPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGISMLTADAKKTRAFMNSSFTIDPKSGDLIFDPVTAFDSGEYYCQAQNGYGTAMRSEAAHMDAVELNVGGIVAAVLVTLILLGLLIFGVWFAYSRGYFERTKKGTAPGKKVIYSQPSTRSEGEFKQTSSFLV

Protein Names:Recommended name: Junctional adhesion molecule A Short name= JAM-A Alternative name(s): Junctional adhesion molecule 1 Short name= JAM-1 CD_antigen= CD321

Gene Names:Name:F11r Synonyms:Jam1, Jcam, Jcam1

Expression Region:27-300

Sequence Info:full length protein

View full details