Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Interleukin-6 receptor subunit alpha(Il6ra)

Recombinant Mouse Interleukin-6 receptor subunit alpha(Il6ra)

SKU:CSB-CF011665MO

Regular price $2,520.00 CAD
Regular price Sale price $2,520.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P22272

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNVTIHWVYSGSQNREWTTTGNTLVLRDVQLSDTGDYLCSLNDHLVGTVPLLVDVPPEEPKLSCFRKNPLVNAICEWRPSSTPSPTTKAVLFAKKINTTNGKSDFQVPCQYSQQLKSFSCQVEILEGDKVYHIVSLCVANSVGSKSSHNEAFHSLKMVQPDPPANLVVSAIPGRPRWLKVSWQHPETWDPSYYLLQFQLRYRPVWSKEFTVLLLPVAQYQCVIHDALRGVKHVVQVRGKEELDLGQWSEWSPEVTGTPWIAEPRTTPAGILWNPTQVSVEDSANHEDQYESSTEATSVLAPVQESSSMSLPTFLVAGGSLAFGLLLCVFIILRLKQKWKSEAEKESKTTSPPPPPYSLGPLKPTFLLVPLLTPHSSGSDNTVNHSCLGVRDAQSPYDNSNRDYLFPR

Protein Names:Recommended name: Interleukin-6 receptor subunit alpha Short name= IL-6 receptor subunit alpha Short name= IL-6R subunit alpha Short name= IL-6R-alpha Short name= IL-6RA Alternative name(s): IL-6R 1 CD_antigen= CD126

Gene Names:Name:Il6ra Synonyms:Il6r

Expression Region:20-460

Sequence Info:full length protein

View full details