Recombinant Mouse Interleukin-11 receptor subunit alpha-2(Il11ra2)

SKU: CSB-CF300280MO

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P70225

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SPCPQAWGPPGVQYGQPGRPVMLCCPGVSAGTPVSWFRDGDSRLLQGPDSGLGHRLVLAQVDSPDEGTYVCQTLDGVSGGMVTLKLGFPPARPEVSCQAVDYENFSCTWSPGQVSGLPTRYLTSYRKKTLPGAESQRESPSTGPWPCPQDPLEASRCVVHGAEFWSEYRINVTEVNPLGASTCLLDVRLQSILRPDPPQGLRVESVPGYPRRLHASWTYPASWRRQPHFLLKFRLQYRPAQHPAWSTVEPIGLEEVITDTVAGLPHAVRVSARDFLDAGTWSAWSPEAWGTPSTGLLQDEIPDWSQGHGQQLEAVVAQEDSLAPARPSLQPDPRPLDHRDPLEQVAVLASLGIFSCLGLAVGALALGLWLRLRRSGKEGPQKPGLLAPMIPVEKLPGIPNLQRTPENFS

Protein Names:Recommended name: Interleukin-11 receptor subunit alpha-2 Short name= IL-11 receptor subunit alpha-2 Short name= IL-11R subunit alpha-2 Short name= IL-11R-alpha-2 Short name= IL-11RA2 Alternative name(s): Interleukin-11 receptor subunit beta Short name= IL-11 receptor subunit beta Short name= IL-11R subunit beta Short name= IL-11R-beta Short name= IL-11RB

Gene Names:Name:Il11ra2

Expression Region:24-432

Sequence Info:full length protein