GeneBio Systems
Recombinant Mouse IL-40 Protein
Recombinant Mouse IL-40 Protein
SKU:Q9CX63
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: Q9CX63
Gene Names: N/A
Alternative Name(s): (Interleukin-40)(IL-40)
Abbreviation: Recombinant Mouse IL40 protein
Organism: Mus musculus (Mouse)
Source: E.coli
Expression Region: 19-252aa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target Protein Sequence: EEQTEGITIAYKVLEVYPQSRRVLITCDAPEASQPITYSLLASRGILVAKKVVHDSVPASFNINITIKSSPDLLTYSCQATSNSGTYGPSSRLQMYQELWAKPVSQLQADFVLRHGDSGPTVELSCLASSGSPPITYRLVGNGGRVLAQQRPLHGKPANFSLPLSQTTGWFQCEAENDVGVDSSARIPLPRAEARAKLVTTLAGELPLTPTCILAGSLVSIAVIASRMLSSTGL
MW: 32.4 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Probable B cell-associated cytokine that plays a role in the regulation of humoral immune responses. Involved in lymphocyte B cell development and immunoglobulin/IgA production.
Reference: "Identification of IL-40, a novel B cell-associated cytokine." Catalan-Dibene J., Vazquez M.I., Luu V.P., Nuccio S.P., Karimzadeh A., Kastenschmidt J.M., Villalta S.A., Ushach I., Pone E.J., Casali P., Raffatellu M., Burkhardt A.M., Hernandez-Ruiz M., Heller G., Hevezi P.A., Zlotnik A. J. Immunol. 199: 3326-3335(2017)
Function:
