Recombinant Mouse Hyaluronan and proteoglycan link protein 1(Hapln1)

Recombinant Mouse Hyaluronan and proteoglycan link protein 1(Hapln1)

CSB-YP010130MO-GB
Regular price
$1,029.92 CAD
Sale price
$1,029.92 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Signal Transduction

Uniprot ID: Q9QUP5

Gene Names: Hapln1

Organism: Mus musculus (Mouse)

AA Sequence: ISVCWADHHLSDSYTPPDQDRVIHIQAENGPRLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLREVDVFVSMGYHKKTYGGYQGRVFLKGGSDNDASLVITDLTLEDYGRYKCEVIEGLEDDTAVVALELQGVVFPYFPRLGRYNLNFHEARQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKLLGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN

Expression Region: 10-356aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 41.4 kDa

Alternative Name(s): Cartilage-linking protein 1 Short name: Cartilage-link protein Proteoglycan link protein

Relevance: Stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the Extracellular domain cartilage matrix.

Reference: "Characterization and chromosomal location of the mouse link protein gene (Crtl1)."Deak F., Mates L., Krysan K., Liu Z., Szabo P.E., Mann J.R., Beier D.R., Kiss I.Cytogenet. Cell Genet. 87:75-79(1999)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share