Gene Bio Systems
Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit beta(Ms4a2)
Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit beta(Ms4a2)
SKU:CSB-CF015013MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:P20490
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDTENRSRADLALPNPQESSSAPDIELLEASPAKAAPPKQTWRTFLKKELEFLGATQILV GLICLCFGTIVCSVLYVSDFDEEVLLLYKLGYPFWGAVLFVLSGFLSIISERKNTLYLVR GSLGANIVSSIAAGTGIAMLILNLTNNFAYMNNCKNVTEDDGCFVASFTTELVLMMLFLT ILAFCSAVLFTIYRIGQELESKKVPDDRLYEELNVYSPIYSELEDKGETSSPVDS
Protein Names:Recommended name: High affinity immunoglobulin epsilon receptor subunit beta Short name= FcERI Alternative name(s): Fc epsilon receptor I beta-chain IgE Fc receptor subunit beta Membrane-spanning 4-domains subfamily A member 2
Gene Names:Name:Ms4a2 Synonyms:Fce1b, Fcer1b, Ms4a1
Expression Region:1-235
Sequence Info:Full length protein
