Size: 10ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Immunology
Uniprot ID: P20489
Gene Names: Fcer1a
Organism: Mus musculus (Mouse)
AA Sequence: ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQLIFPLLVAILFAVDTGLLLSTEEQFKSVLEIQKTGKYKKVETELLT
Expression Region: 24-250aa
Sequence Info: Full Length of Mature Protein
Source: in vitro E.coli expression system
Tag Info: N-terminal 10xHis-SUMO-tagged
MW: 44.7 kDa
Alternative Name(s): Fc-epsilon RI-alpha
Relevance: Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
Reference: "Transcription mapping and expression analysis of candidate genes in the vicinity of the mouse Loop-tail mutation." Underhill D.A., Vogan K.J., Kibar Z., Morrison J., Rommens J., Gros P. Mamm. Genome 11:633-638(2000)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.