Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha(Fcer1a)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha(Fcer1a)

CSB-CF008532MO
Regular price
$1,360.00 CAD
Sale price
$1,360.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 10ug

Updated Date: Stock Protein updated on 20171228

Research areas: Immunology

Target / Protein: Fcer1a

Biologically active: Not Tested

Expression system: in vitro E.coli expression system

Species of origin: Mus musculus (Mouse)

Delivery time: 3-7 business days

Uniprot ID: P20489

AA Sequence: ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQLIFPLLVAILFAVDTGLLLSTEEQFKSVLEIQKTGKYKKVETELLT

Tag info: N-terminal 10xHis-SUMO-tagged

Expression Region: 24-250aa

Protein length: Full Length of Mature Protein

MW: 44.7 kDa

Alternative Name(s): Fc-epsilon RI-alpha

Relevance: Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.

Reference: "Transcription mapping and expression analysis of candidate genes in the vicinity of the mouse Loop-tail mutation." Underhill D.A., Vogan K.J., Kibar Z., Morrison J., Rommens J., Gros P. Mamm. Genome 11:633-638(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share