Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), partial (Active)

SKU: O35659

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Neuroscience

Uniprot ID: O35659

Gene Names: Glp1r

Alternative Name(s): Glucagon-like peptide 1 receptor; GLP-1 receptor; GLP-1-R; GLP-1R;Glp1r

Abbreviation: Recombinant Mouse Glp1r protein, partial (Active)

Organism: Mus musculus (Mouse)

Source: Mammalian cell

Expression Region: 22-145aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY

MW: 15.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse Glp1r at 2 μg/mL can bind Anti-GLP1R recombinant antibody (CSB-RA009514MA3HU). The EC50 is 141.7-172.4 ng/mL.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels. Plays a role in regulating insulin secretion in response to GLP-1. Selective recognition of glucagon-like peptide over glucagon is determined by residues located at the C-terminal end of the glucagon-like peptide.

Reference: A vagal reflex evoked by airway closure. Schappe M.S., Brinn P.A., Joshi N.R., Greenberg R.S., Min S., Alabi A.A., Zhang C., Liberles S.D. Nature 627: 830-838 (2024)

Function: