Recombinant Mouse FXYD domain-containing ion transport regulator 5(Fxyd5)

SKU: CSB-CF009093MO

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P97808

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QTPKKPTSIFTADQTSATTRDNVPDPDQTSPGVQTTPLIWTREEATGSQTAAQTETQQLTKMATSNPVSDPGPHTSSKKGTPAVSRIEPLSPSKNFMPPSYIEHPLDSNENNPFYYDDTTLRKRGLLVAAVLFITGIIILTSGKCRQLSQFCLNRHR

Protein Names:Recommended name: FXYD domain-containing ion transport regulator 5 Alternative name(s): EF-8 Ion channel homolog RIC Oncoprotein-induced protein 2

Gene Names:Name:Fxyd5 Synonyms:Oit2

Expression Region:22-178

Sequence Info:full length protein