Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit(Ddost)

Recombinant Mouse Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit(Ddost)

SKU:CSB-CF006594MO

Regular price $2,479.40 CAD
Regular price Sale price $2,479.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:O54734

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GPRTLVLLDNLNVRDTHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDVSDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGRNTLLIAGLQARNNARVIFSGSLDFFSDAFFNSAVQKATPGAQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGEMAPPNAYTVTDLVEYSIIIEQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKRKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMAGLFIFSIVFLHMKEKEKSD

Protein Names:Recommended name: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit Short name= DDOST 48 kDa subunit Short name= Oligosaccharyl transferase 48 kDa subunit EC= 2.4.1.119

Gene Names:Name:Ddost

Expression Region:29-441

Sequence Info:full length protein

View full details