Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Claudin-5(Cldn5)

Recombinant Mouse Claudin-5(Cldn5)

SKU:CSB-CF005507MO

Regular price $2,191.00 CAD
Regular price Sale price $2,191.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:O54942

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTG HMQCKVYESVLALSAEVQAARALTVGAVLLALVALFVTLTGAQCTTCVAPGPVKARVALT GGALYAVCGLLALVPLCWFANIVVREFYDPTVPVSQKYELGAALYIGWAASALLMCGGGL VCCGAWVCTGRPEFSFPVKYSAPRRPTANGDYDKKNYV

Protein Names:Recommended name: Claudin-5 Alternative name(s): Brain endothelial cell clone 1 protein Lung-specific membrane protein

Gene Names:Name:Cldn5 Synonyms:Bec1

Expression Region:1-218

Sequence Info:Full length protein

View full details