
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P97391
Gene Names: Pla2g5
Organism: Mus musculus (Mouse)
AA Sequence: GLLELKSMIEKVTGKNAFKNYGFYGCYCGWGGRGTPKDGTDWCCQMHDRCYGQLEEKDCAIRTQSYDYRYTNGLVICEHDSFCPMRLCACDRKLVYCLRRNLWTYNPLYQYYPNFLC
Expression Region: 21-137aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 29.8 kDa
Alternative Name(s): Group V phospholipase A2;PLA2-10Phosphatidylcholine 2-acylhydrolase 5
Relevance: PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes L-alpha-palmitoyl-2-oleoyl phosphatidylcholine more efficiently than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol .
Reference: Low-molecular-weight, calcium-dependent phospholipase A2 genes are linked and map to homologous chromosome regions in mouse and human.Tischfield J.A., Xia Y.R., Shih D.M., Klisak I., Chen J., Engle S.J., Siakotos A.N., Winstead M.V., Seilhamer J.J., Allamand V., Gyapay G., Lusis A.Genomics 32:328-333(1996)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.