Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P18340
Gene Names: Cxcl9
Organism: Mus musculus (Mouse)
AA Sequence: TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKISQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT
Expression Region: 22-126aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 16.2 kDa
Alternative Name(s): Gamma-interferon-induced monokine;Monokine induced by interferon-gamma ;MIG ;MuMIGProtein m119Small-inducible cytokine B9
Relevance: May be a cytokine that affects the growth, movent, or activation state of cells that participate in immune and inflammatory response.
Reference: A macrophage mRNA selectively induced by gamma-interferon encodes a member of the platelet factor 4 family of cytokines.Farber J.M.Proc. Natl. Acad. Sci. U.S.A. 87:5238-5242(1990)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.