Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q9WUQ5
Gene Names: Cxcl14
Organism: Mus musculus (Mouse)
AA Sequence: SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Expression Region: 23-99aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 13.4 kDa
Alternative Name(s): B-cell and monocyte-activating chemokineChemokine BRAKKidney-expressed chemokine CXCMIP-2GSmall-inducible cytokine B14
Relevance: Chotactic for CESS B-cells and THP-1 monocytes, but not T-cells.
Reference: Cloning of BRAK, a novel divergent CXC chemokine preferentially expressed in normal versus malignant cells.Hromas R., Broxmeyer H.E., Kim C., Nakshatri H., Christopherson K. II, Azam M., Hou Y.-H.Biochem. Biophys. Res. Commun. 255:703-706(1999)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.