Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q91ZZ3
Gene Names: Sncb
Organism: Mus musculus (Mouse)
AA Sequence: MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTSGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKKEEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDSPQEEYQEYEPEA
Expression Region: 1-133aa
Sequence Info: Full Length
Source: E.coli
Tag Info: NO-tagged
MW: 14.1 kDa
Alternative Name(s):
Relevance: May be involved in neuronal plasticity.
Reference: "Genomic organization, chromosome location, and expression analysis of mouse beta-synuclein, a candidate for involvement in neurodegeneration." Sopher B.L., Koszdin K.L., McClain M.E., Myrick S.B., Martinez R.A., Smith A.C., La Spada A.R. Cytogenet. Cell Genet. 93:117-123(2001)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.