Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Asialoglycoprotein receptor 2(Asgr2)

Recombinant Mouse Asialoglycoprotein receptor 2(Asgr2)

SKU:CSB-CF002208MO

Regular price $2,314.20 CAD
Regular price Sale price $2,314.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P24721

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEKDCQDIQQLDSEENDHQLSGDDEHGSHVQDPRIENPHWKGQPLSRPFPQRLCSTFRLSLLALAFNILLLVVICVVSSQSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNITH

Protein Names:Recommended name: Asialoglycoprotein receptor 2 Short name= ASGP-R 2 Short name= ASGPR 2 Alternative name(s): Hepatic lectin 2 Short name= HL-2 Short name= mHL-2

Gene Names:Name:Asgr2 Synonyms:Asgr-2

Expression Region:1-301

Sequence Info:full length protein

View full details