
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171018
Research areas: Others
Target / Protein: Slc7a10
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Mus musculus (Mouse)
Delivery time: 3-7 business days
Uniprot ID: P63115
AA Sequence: WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITDKPLKTQ
Tag info: N-terminal 6xHis-sumostar-tagged
Expression Region: 475-530aa
Protein length: Partial
MW: 22.5 kDa
Alternative Name(s): D-serine transporter Solute carrier family 7 member 10
Relevance: Sodium-independent, high affinity transport of small neutral D- and L-amino acids and amino acid-related compounds. May play a role in the modulation of glutamatergic transmission through mobilization of D-serine at the glutamatergic synapse.
Reference: "Identification and characterization of a Na+-independent neutral amino acid transporter that associates with the 4F2 heavy chain and exhibits substrate selectivity for small neutral D- and L- amino acids." Fukasawa Y., Segawa H., Kim J.Y., Chairoungdua A., Kim D.K., Matsuo H., Cha S.H., Endou H., Kanai Y. J. Biol. Chem. 275:9690-9698(2000)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.