Gene Bio Systems
Recombinant Mitochondrial inner membrane organizing system protein F54A3.5(F54A3.5)
Recombinant Mitochondrial inner membrane organizing system protein F54A3.5(F54A3.5)
SKU:CSB-CF885645CXY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Caenorhabditis elegans
Uniprot NO.:Q9N4K0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAPGASAPAASRSEDEVGQKIDRCFADSLLKVTGGVAIGIVASVAFFKSRSWPIWFGSGV GLGTGWSNCRHDFASPYVLHGKRVPAGQDSQGKPAYNIITEQHKQ
Protein Names:Recommended name: Mitochondrial inner membrane organizing system protein F54A3.5
Gene Names:ORF Names:F54A3.5
Expression Region:1-105
Sequence Info:full length protein
