Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mitochondrial import receptor subunit TOM20 homolog(tomm-20)

Recombinant Mitochondrial import receptor subunit TOM20 homolog(tomm-20)

SKU:CSB-CF024046CXX

Regular price $2,146.20 CAD
Regular price Sale price $2,146.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Caenorhabditis briggsae

Uniprot NO.:A8Y3V5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTDTLFGFNKSNVVLAAGVAGAAFLGYCIYFDHKRINAPDYKDKIRQKRRAQAGSGGMAARRPPAGGNEMAPDVTDPSQMQRFFLQEVQLGEELMAAGNVEEGAVHIANAVMLCGESQQLLSIFQQTLSEEQFRAVVQQLPSTRERLADMFGARADEAENEPPLVQYLGDGPPPAQIQELIDDTDDLE

Protein Names:Recommended name: Mitochondrial import receptor subunit TOM20 homolog Alternative name(s): Translocase of outer mitochondrial membrane protein 20

Gene Names:Name:tomm-20 ORF Names:CBG23457

Expression Region:1-188

Sequence Info:full length protein

View full details