Skip to product information
1 of 1

Gene Bio Systems

Recombinant Meyerozyma guilliermondii Golgi apparatus membrane protein TVP18(TVP18)

Recombinant Meyerozyma guilliermondii Golgi apparatus membrane protein TVP18(TVP18)

SKU:CSB-CF398509MTM

Regular price $2,123.80 CAD
Regular price Sale price $2,123.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) (Yeast) (Candida guilliermondii)

Uniprot NO.:A5DEQ7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MALSISTVMSNVFGGFSADFKKKNFSLYGQWIGLFTIILCLALGIANIFHASLVIIFSII CIVQGLVVVFVEVPFLLRICPLTDKFTSFIKNFDENWPRCGFYLLMSVIQWLSLTLQTTS LIVVAVFFALASACYALAAIKHQEYLKTSFNVAGEQGSLEAQVGEHVVRNVL

Protein Names:Recommended name: Golgi apparatus membrane protein TVP18

Gene Names:Name:TVP18 ORF Names:PGUG_01758

Expression Region:1-172

Sequence Info:full length protein

View full details