Gene Bio Systems
Recombinant Methylobacterium radiotolerans Protein CrcB homolog(crcB)
Recombinant Methylobacterium radiotolerans Protein CrcB homolog(crcB)
SKU:CSB-CF542743MTD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831)
Uniprot NO.:B1M4Y4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSFTTCILVMIGGALGTLARYVVSVLSLPISRDLPWGTILINVTGSFIIGLFGTLTLAQG RFPVSENVRLFVMIGLCGGYTTFSSFSLQTLDLMRNGAVVRAMVNVCASVVLCVLAVALG HVVAAHWNGGAVQIAQVSIEEDG
Protein Names:Recommended name: Protein CrcB homolog
Gene Names:Name:crcB Ordered Locus Names:Mrad2831_4479
Expression Region:1-143
Sequence Info:full length protein
