Gene Bio Systems
Recombinant Methylobacterium populi Large-conductance mechanosensitive channel(mscL)
Recombinant Methylobacterium populi Large-conductance mechanosensitive channel(mscL)
SKU:CSB-CF456061MTC
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Uniprot NO.:B1ZC68
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLEEFKKFALRGNVVDLAVGVIIGAAFGAIVNSLVQDVIMPIIGAITGGLDFSNYYIPLS SKVQAGMPYAEAKKVGAVIGYGQFLTLAVNFTIIAFVLFMVIRAMNGLKSKEEAKPKPEA EVPADVKLLAEIRDLLAARREA
Protein Names:Recommended name: Large-conductance mechanosensitive channel
Gene Names:Name:mscL Ordered Locus Names:Mpop_2607
Expression Region:1-142
Sequence Info:full length protein
