Gene Bio Systems
Recombinant Methylobacillus flagellatus UPF0060 membrane protein Mfla_0485(Mfla_0485)
Recombinant Methylobacillus flagellatus UPF0060 membrane protein Mfla_0485(Mfla_0485)
SKU:CSB-CF625334MAAN
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)
Uniprot NO.:Q1H432
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLVLKTFSLFILTALAEILGCYLPYLWLKKDGSVWLLLPAAISLAVFAWLLSLHPTAAGR VYAAYGGVYIFVALGWLWLVDGIRPSTWDFVGVGVALAGMAIIMFAPR
Protein Names:Recommended name: UPF0060 membrane protein Mfla_0485
Gene Names:Ordered Locus Names:Mfla_0485
Expression Region:1-108
Sequence Info:full length protein
