Gene Bio Systems
Recombinant Methanothermobacter thermautotrophicus Tetrahydromethanopterin S-methyltransferase subunit B(mtrB)
Recombinant Methanothermobacter thermautotrophicus Tetrahydromethanopterin S-methyltransferase subunit B(mtrB)
SKU:CSB-CF517962MSR
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)
Uniprot NO.:O27228
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEMLPLVKIAPEYNLTLDPSTGMIGAALGREVIILSMDEINEQIAELEATADDLINSLDP TTTPLDSYPGREGVYLTAGKLTNMVYGFILGLIILFALLL
Protein Names:Recommended name: Tetrahydromethanopterin S-methyltransferase subunit B EC= 2.1.1.86 Alternative name(s): N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit B
Gene Names:Name:mtrB Ordered Locus Names:MTH_1160
Expression Region:1-100
Sequence Info:full length protein
