Gene Bio Systems
Recombinant Methanosphaerula palustris UPF0290 protein Mpal_2361 (Mpal_2361)
Recombinant Methanosphaerula palustris UPF0290 protein Mpal_2361 (Mpal_2361)
SKU:CSB-CF488709MSP
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
Uniprot NO.:B8GEE2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLPAYLPNPAAALFGGGTPIDGGRRWSDGRRLLGDGKTWRGLVLGILSGVLLGLIQVSVQ DACVFVWLPRHTVLSVLLLAVGALAGDMVKSFVKRRIGKERGAAWPLADQYDLVAGSLLL LLIGDYGFAAVNLTIPVIFWILVLTPLLHRAVNLIGYAIGVKDVPW
Protein Names:Recommended name: UPF0290 protein Mpal_2361
Gene Names:Ordered Locus Names:Mpal_2361
Expression Region:1-166
Sequence Info:full length protein
