Gene Bio Systems
Recombinant Methanosphaerula palustris Putative cobalt transport protein CbiM 2(cbiM2)
Recombinant Methanosphaerula palustris Putative cobalt transport protein CbiM 2(cbiM2)
SKU:CSB-CF491265MSP
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
Uniprot NO.:B8GEB7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MHIMEGFLPAGWCLVWWLIALPFLVMGIIQLRRMMKEDREYLPLLGVCGAFIFILSALKL PSVTGSCSHPTGTGLSTICFGYCVTAVVGAIVLLFQALLLAHGGLSTMGANMVSMAIGGP IAGYAVYKLMKDTSINIYVTVFLASAVADIVTYIITSFELALAYPAQVGGFLASFSAFFS IFAITQIPLSIMEGVVLALVFKYIIQLKPEIILKLHVFSEEQIAKARLAGDAEVA
Protein Names:Recommended name: Putative cobalt transport protein CbiM 2 Alternative name(s): Energy-coupling factor transporter probable substrate-capture protein CbiM 2 Short name= ECF transporter S component CbiM 2
Gene Names:Name:cbiM2 Ordered Locus Names:Mpal_2333
Expression Region:1-235
Sequence Info:full length protein
