Gene Bio Systems
Recombinant Methanosarcina barkeri UPF0290 protein Mbar_A3516(Mbar_A3516)
Recombinant Methanosarcina barkeri UPF0290 protein Mbar_A3516(Mbar_A3516)
SKU:CSB-CF674961MSM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Methanosarcina barkeri (strain Fusaro / DSM 804)
Uniprot NO.:Q465Q6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLPAYLSNPFAAVFGGGKPIDGGRTYKDGRRILGDGKTYRGLFSGIFCGFIAGCIEIWLS SRGFEIMGINMPVFGPDYKSALIVVLALASGALFGDMFKSFFKRRMGLKRGASLPLVDQL DFVVGAWVFTYLVAPEWFVSNFTHGIMLTVIIITPLLHLTTNIIGYLIGVKKEPW
Protein Names:Recommended name: UPF0290 protein Mbar_A3516
Gene Names:Ordered Locus Names:Mbar_A3516
Expression Region:1-175
Sequence Info:full length protein
