Gene Bio Systems
Recombinant Methanosarcina barkeri Tetrahydromethanopterin S-methyltransferase subunit G(mtrG)
Recombinant Methanosarcina barkeri Tetrahydromethanopterin S-methyltransferase subunit G(mtrG)
SKU:CSB-CF897359MSM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Methanosarcina barkeri (strain Fusaro / DSM 804)
Uniprot NO.:Q9Y8K6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDGKAPAAFVEPGEFNEVMKRLDKIDEKIEFVNSEVAQKIGKKVGRDIGILYGGFIGLLL FLIYTVVSSMFM
Protein Names:Recommended name: Tetrahydromethanopterin S-methyltransferase subunit G EC= 2.1.1.86 Alternative name(s): N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit G
Gene Names:Name:mtrG Ordered Locus Names:Mbar_A1256
Expression Region:1-72
Sequence Info:full length protein
