Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanosarcina barkeri Putative cobalt transport protein CbiM 1(cbiM1)

Recombinant Methanosarcina barkeri Putative cobalt transport protein CbiM 1(cbiM1)

SKU:CSB-CF670525MSM

Regular price $2,210.60 CAD
Regular price Sale price $2,210.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Methanosarcina barkeri (strain Fusaro / DSM 804)

Uniprot NO.:Q46D59

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHIFEGFLPGPWWQIWWILSIPVFAYGIFRLNKLVKEKPEVLPLIAVSGAVIFVLSSLKL PSVTGSTSHPTGTGMAVILFGPAITSVLSAIVLLYQALFLAHGGITTFGANLMSMGIIGP FVAYAIYKTMMRLNVNFYVSAFVTATLADWVTYVVTSTQLALAFPANPGGVEGSLVAFLS VFAITQIPLAILEASLITLLFKYVLQAKGDLMVRLDVLTDSQVRKLKETKA

Protein Names:Recommended name: Putative cobalt transport protein CbiM 1 Alternative name(s): Energy-coupling factor transporter probable substrate-capture protein CbiM 1 Short name= ECF transporter S component CbiM 1

Gene Names:Name:cbiM1 Ordered Locus Names:Mbar_A1216

Expression Region:1-231

Sequence Info:full length protein

View full details