Gene Bio Systems
Recombinant Methanosarcina acetivorans UPF0290 protein MA_3306(MA_3306)
Recombinant Methanosarcina acetivorans UPF0290 protein MA_3306(MA_3306)
SKU:CSB-CF848463MFB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Uniprot NO.:Q8TKT8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLPAYLSNPFAAVFGGGKPIDGGRTYKDGRRILGDGKTYRGLFSGIFCGFLAGCIEIWLS MRGFEIMGIKMPTFGPNYASALIVVLALPSGALFGDMFKSFFKRRMGLKRGASLPLVDQL DFVVGAWFFTYLAAPEWFVSNFTTGIALTVLIMTPLLHLTTNIIGYFIGVKKEPW
Protein Names:Recommended name: UPF0290 protein MA_3306
Gene Names:Ordered Locus Names:MA_3306
Expression Region:1-175
Sequence Info:full length protein
