Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Uniprot NO.:Q8TIQ3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIGTGGFIGASLRYTISSRVPKIQNIPAGTLTVNLLGSIVLALLTFSSEPESVVYLVNIG MLGSFTTFSTFAYETFRLLEDGQNISFFLNIFLNVMLCLLGVSIAYLALML
Protein Names:Recommended name: Protein CrcB homolog 3
Gene Names:Name:crcB3 Ordered Locus Names:MA_4089
Expression Region:1-111
Sequence Info:full length protein