Gene Bio Systems
Recombinant Methanosaeta thermophila UPF0290 protein Mthe_1386 (Mthe_1386)
Recombinant Methanosaeta thermophila UPF0290 protein Mthe_1386 (Mthe_1386)
SKU:CSB-CF366941MNW
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Methanosaeta thermophila (strain DSM 6194 / PT) (Methanothrix thermophila (strain DSM 6194 / PT))
Uniprot NO.:A0B8Y7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNIIVHSIWLMLPAYVPNNFAALFGGGTPLDMGMSLPDGHRVFGNGKTIRGTIAGVAGGI IVGLLQNSIAGVFGLPSFGDGMELFLVLFGLSAGSMLGDLTASFIKRRLGMKRGASFFLV DQLDFVMGAWALTFLLAPEWFNAQFTSPVIILVLLITPVLHRFANVIGYMIGAKKEPW
Protein Names:Recommended name: UPF0290 protein Mthe_1386
Gene Names:Ordered Locus Names:Mthe_1386
Expression Region:1-178
Sequence Info:full length protein
