Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanocorpusculum labreanum UPF0059 membrane protein Mlab_0221 (Mlab_0221)

Recombinant Methanocorpusculum labreanum UPF0059 membrane protein Mlab_0221 (Mlab_0221)

SKU:CSB-CF383616MNT

Regular price $2,142.00 CAD
Regular price Sale price $2,142.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)

Uniprot NO.:A2SPZ1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTDLLLSSLVIAVGLAMDSFSVSLAGGAALKDNIVKTAVTAGIFFGFFQFAMPLLGWGIG VPITQVIDPFGYWIVVGLFFFIGGKMIWDSFSGDEEGISLIGWKVLLLLAVATSIDALAV GISFALIGEAVLLPAVIIGVVAFLFSFFGVLAGHKLSSILGNKMQILGGVILVLIGIKFL IEYCL

Protein Names:Recommended name: UPF0059 membrane protein Mlab_0221

Gene Names:Ordered Locus Names:Mlab_0221

Expression Region:1-185

Sequence Info:full length protein

View full details