Gene Bio Systems
Recombinant Methanococcus vannielii UPF0290 protein Mevan_1000 (Mevan_1000)
Recombinant Methanococcus vannielii UPF0290 protein Mevan_1000 (Mevan_1000)
SKU:CSB-CF413496MNS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224)
Uniprot NO.:A6UQY1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDLINLLFVSFWFILPAYTANAMACIFGGGKPVDLNKNFIDQKRLIGNGVTYRGTFFGVF FGIVTAIIQYLVSNLGFKFILSFNFTLIEYVIIGFLLSFGALFGDMFGSFLKRRLGFKQG QSAPVLDQITFIVFALIFVSYYYLVPSKISITLLILSPVVHILSNIIAYKLGLKKVWW
Protein Names:Recommended name: UPF0290 protein Mevan_1000
Gene Names:Ordered Locus Names:Mevan_1000
Expression Region:1-178
Sequence Info:full length protein
