
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
Uniprot NO.:A9A9I2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEFKHVLMILGVIILTLAPLIMYSGLGEDEGYFGGADGAAGDLIMEISPNYEPWFEPFWE PPSGEIESLLFALQAAIGAMIIGYFFGYNKAKYDDKN
Protein Names:Recommended name: Cobalt transport protein CbiN Alternative name(s): Energy-coupling factor transporter probable substrate-capture protein CbiN Short name= ECF transporter S component CbiN
Gene Names:Name:cbiN Ordered Locus Names:MmarC6_1192
Expression Region:1-97
Sequence Info:full length protein