Recombinant Methanococcus maripaludis Cobalt transport protein CbiN(cbiN)

SKU: CSB-CF389453MNP

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Methanococcus maripaludis (strain C5 / ATCC BAA-1333)

Uniprot NO.:A4FW42

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEFKHVLMILGVIILILAPLIMYSGLGEDEGYFGGADGAAGDLIMEISPNYEPWFEPFWE PPSGEIESLLFALQAAIGAIIIGYFFGYNKAKYEDKN

Protein Names:Recommended name: Cobalt transport protein CbiN Alternative name(s): Energy-coupling factor transporter probable substrate-capture protein CbiN Short name= ECF transporter S component CbiN

Gene Names:Name:cbiN Ordered Locus Names:MmarC5_0096

Expression Region:1-97

Sequence Info:full length protein