Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Uniprot NO.:Q58781
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKIYDAVVKTTFQISTSIFFDYIYFFDYKGMKMAEIFAVNNYTELKKIRRMITFGFTVLG LGIGMIFGDAGLDV
Protein Names:Recommended name: Uncharacterized protein MJ1386
Gene Names:Ordered Locus Names:MJ1386
Expression Region:1-74
Sequence Info:full length protein